You have no items in your shopping cart.
Human TGFB2 Protein
SKU: orb428807
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Nicotiana benthamiana |
|---|---|
| Biological Activity | The biological activity of TGFB2 is measured in culture by its ability to inhibit the mink lung epithelial (Mv1Lu) cells proliferation. ED50 < 40ng/ml, corresponding to a specific activity of 25,000 units/mg. |
| Protein Sequence | HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTI LYYIGKTPKIEQLSNMIVKSCKCS |
| Purity | Greater than 97.0% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | Stability: Lyophilized TGFB2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TGFB2 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | Lyophilized from a concentrated (1mg/ml) solution containing 50mM Tris-HCl pH-7.4. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Transforming growth factor, beta 2, cetermin, Glioblastoma-derived T-cell suppressor factor, polyergin, G-TSF, TGF-beta2, TGF-beta-2, transforming growth factor beta-2, BSC-1 cell growth inhibitor, TGFB-2.
Similar Products
−- Item 1 of 1
Human Transforming Growth Factor Beta 2 (TGF-β2) ELISA Kit [orb1807182]
Human
31.25-2000pg/mL
13.7 pg/mL
96 T, 48 T Recombinant Human TGF-beta 2 Protein (Biotin) [orb2993079]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 12.7&36 KDa. Observed: 13&39-50 KDa, reducing conditions
20 μg, 100 μgRecombinant Human TGF-beta 2 Protein (Biotin) [orb2993087]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 14.5 KDa. Observed: 10-14 KDa, reducing conditions
20 μg, 100 μg- Item 1 of 3
Human TGFB2 protein [orb418749]
Greater than 90% as determined by SDS-PAGE.
16.7 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 2
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human TGFB2 Protein (orb428807)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days