You have no items in your shopping cart.
Human TNR11 protein (Active)
SKU: orb359202
Featured
Active
Description
Research Area
Cancer Biology
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit sRANK Ligand induced nuclear factor kappa B(NFkappaB) in RAW 264.7 cells is less than 50 ng/ml, corresponding to a specific activity of > 2.0 x 10 ^ 4 IU/mg in the presence of 15 ng/ml of recombinant sRANK Ligand. |
| Tag | Tag-Free |
| Molecular Weight | 19.1 kDa |
| Expression Region | 29-202aa |
| Protein Length | Partial |
| Protein Sequence | QIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARK |
| Purity | > 98% as determined by SDS-PAGE and HPLC. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, pH 8.0, 150mM NaCl |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Osteoclast differentiation factor receptor, Receptor activator of NF-KB, CD antigen CD265

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SDS-PAGE analysis of Human TNR11 protein (Active)
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human TNR11 protein (Active) (orb359202)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review