Cart summary

You have no items in your shopping cart.

LDHA Rabbit Polyclonal Antibody

SKU: orb582473

Description

Rabbit polyclonal antibody to LDHA

Research Area

Epigenetics & Chromatin, Molecular Biology, Signal Transduction

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human LDHA
TargetLDHA
Protein SequenceSynthetic peptide located within the following region: ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALV
Molecular Weight37 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

LDHM, GSD11, PIG19, HEL-S-133P

Similar Products

  • LDHA Rabbit Polyclonal Antibody [orb381077]

    FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • LDHA Rabbit Polyclonal Antibody [orb582474]

    IHC-P,  WB

    Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • LDHA Rabbit Polyclonal Antibody [orb13539]

    ELISA,  IF,  IHC-Fr,  IHC-P

    Bovine, Human, Porcine, Rabbit, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • LDHA Specific Rabbit Polyclonal Antibody [orb395266]

    ELISA,  FC,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • LDHA Rabbit Polyclonal Antibody [orb628406]

    ELISA,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

LDHA Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Isoforms of ~35 kDa and 30 kDa also contain the peptide.

LDHA Rabbit Polyclonal Antibody

Anti-LDHA antibody IHC of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. LDHA Antibody concentration 2.5 ug/ml.

LDHA Rabbit Polyclonal Antibody

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 3 ug/ml.

LDHA Rabbit Polyclonal Antibody

Sample Tissue: Human Hela, Antibody dilution: 1.0 ug/ml.

LDHA Rabbit Polyclonal Antibody

Sample Tissue: Human Ovary Tumor, Antibody dilution: 1 ug/ml.

LDHA Rabbit Polyclonal Antibody

LDHA antibody - N-terminal region (orb582473) validated by WB using LdhC knockout mouse sperm, LdhA transgenic kidney, IdhA transgenic testis, LdhC knockout testis at 1:1000.

LDHA Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

LDHA Rabbit Polyclonal Antibody

WB Suggested Anti-LDHA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Placenta.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005557

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

LDHA Rabbit Polyclonal Antibody (orb582473)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry