Cart summary

You have no items in your shopping cart.

MAPK1 Rabbit Polyclonal Antibody

SKU: orb584155

Description

Rabbit polyclonal antibody to ERK1/2

Research Area

Cell Biology, Epigenetics & Chromatin, Protein Biochemistry, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Rat
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human MAPK1
TargetMAPK1
Protein SequenceSynthetic peptide located within the following region: PYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Molecular Weight41 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

ERK, p38, p40, p41, ERK2, ERT1, NS13, ERK-2, MAPK2, PRKM1, PRKM2, P42MAPK, p41mapk, p42-MAPK

Similar Products

  • Phospho-ERK1/2 (Thr202 + Tyr204) Rabbit Polyclonal Antibody [orb5178]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Guinea pig, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-ERK1 (Thr202/Tyr204) + ERK2 (Thr183/Tyr185) Rabbit Polyclonal Antibody [orb783430]

    FC,  IF,  IHC

    Bovine, Canine, Equine, Gallus, Guinea pig, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • ERK1 + ERK2 Rabbit Polyclonal Antibody [orb10604]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Goat, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • ERK1 + ERK2 Rabbit Polyclonal Antibody [orb6018]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Goat, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • ERK 1/2 (phospho Tyr222/205) Polyclonal Antibody [orb1415176]

    IF,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

MAPK1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment.

MAPK1 Rabbit Polyclonal Antibody

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

MAPK1 Rabbit Polyclonal Antibody

Sample Type: Human Jurkat, Antibody dilution: 1.0 ug/ml. MAPK1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

MAPK1 Rabbit Polyclonal Antibody

Sample Tissue: Rat Skeletal Muscle, Antibody dilution: 1 ug/ml.

MAPK1 Rabbit Polyclonal Antibody

Rabbit Anti-MAPK1 Antibody, Catalog Number: orb584155, Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

MAPK1 Rabbit Polyclonal Antibody

WB Suggested Anti-MAPK1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_620407

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

MAPK1 Rabbit Polyclonal Antibody (orb584155)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry