MERSC-CoV Spike Protein Antibody

SKU: orb334976

Description

Goat polyclonal to Spike protein of Middle East respiratory Syndrome coronavirus. Coronaviruses access host cells by membrane fusion, a process mediated by specific fusion or “spike” proteins on the virion, often activated by cellular proteases.

Images & Validation

−

Item 1 of 1

Tested Applications	WB
Dilution Range	WB:1:500-1:2,000
Reactivity	Virus
Application Notes	The antibody solution should be gently mixed before use.

Key Properties

−

Host	Goat
Clonality	Polyclonal
Isotype	IgG
Immunogen	Antigen: Purified recombinant peptide derived from within residues 381-505 aa (Spike receptor binding domain) of Spike protein from Middle East respiratory syndrome coronavirus produced in E. coli. Antigen Sequence: VECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSR
Purification	Epitope affinity purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Form/Appearance	Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Concentration	Please inquire
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

S-protein MERS-CoV antibody.

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Western blot analysis of staining of HEK293 transfected cell lysates using MERSC-CoV Spike Protein antibody

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols