You have no items in your shopping cart.
Monkey IL1 alpha protein (Active)
SKU: orb358997
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Macaca mulatta (Rhesus macaque) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 10 pg/ml, corresponding to a specific activity of > 1.0 x 10 ^ 8 IU/mg. |
| Tag | Tag-Free |
| Molecular Weight | 18.1 kDa |
| Expression Region | 113-271aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | SAPFSFLSNMTYHFIRIIKHEFILNDTLNQTIIRANDQHLTAAAIHNLDEAVKFDMGAYTSSKDDTKVPVILRISKTQLYVSAQDEDQPVLLKEMPEINKTITGSETNFLFFWETHGTKNYFISVAHPNLFIATKHDNWVCLAKGLPSITDFQILENQA |
| Purity | > 97% as determined by SDS-PAGE and HPLC. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Hematopoietin 1 protein, Hematopoietin-1 protein, IL 1 alpha protein, IL 1 protein, IL 1A protein, IL-1 alpha protein, Il-1a protein, IL1 ALPHA protein, IL1 protein, IL1A protein, IL1A_HUMAN protein, IL1F1 protein, ilia protein, Interleukin 1 alpha protein, Interleukin 1 alpha precursor protein, Interleukin-1 alpha protein, Interleukin1 alpha protein, Preinterleukin 1 alpha protein, Pro interleukin 1 alpha protein

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Monkey IL1 alpha protein (Active) (orb358997)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review