Cart summary

You have no items in your shopping cart.

Monkey IL6 protein (Active)

SKU: orb358999
FeaturedFeatured Product
ActiveBiologically Active

Description

This Monkey IL6 protein (Active) spans the amino acid sequence from region 28-212aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Research Area

Immunology & Inflammation

Images & Validation

Application Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

SourceE.Coli
Biological OriginMacaca mulatta (Rhesus macaque)
Biological ActivityFully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay usingIL-6-dependent murine 7TD1 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 x 10 ^ 7 IU/mg.
TagTag-Free
Molecular Weight21.1 kDa
Expression Region28-212aa
Protein LengthFull Length of Mature Protein
Protein SequenceM+APVLPGEDSKNVAAPHSQPLTSSERIDKHIRYILDGISALRKETCNRSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEDTCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPEPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSNLRALRQM
Purity> 97% as determined by SDS-PAGE and HPLC.
EndotoxinsLess than 1.0 EU/μg as determined by LAL method.

Storage & Handling

StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized from a 0.2 µm filtered concentrated solution in 50 mM Tris-HCl, pH 9.0, 600 mM NaCl, with 0.02 % Tween-20.
DisclaimerFor research use only

Alternative Names

Interleukin BSF 2 protein, B cell differentiation factor protein, B cell stimulatory factor 2 protein, BSF 2 protein, BSF-2 protein, BSF2 protein, CDF protein, CTL differentiation factor protein, Cytotoxic T cell differentiation factor protein, HGF protein, HPGF protein, HSF protein, Hybridoma growth factor protein, Hybridoma growth factor Interferon beta-2 protein, Hybridoma plasmacytoma growth factor protein, IFN-beta-2 protein, IFNB2 protein, IL 6 protein, IL-6 protein, IL6 protein, IL6 protein protein, Interferon beta 2 protein, Interferon beta-2 protein, Interleukin 6 (interferon beta 2) protein, Interleukin 6 protein, Interleukin BSF 2 protein, Interleukin-6 protein, Interleukin6 protein
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Monkey IL6 protein (Active)

UniProt Details

No UniProt data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Monkey IL6 protein (Active) (orb358999)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

10 μg
$ 380.00
100 μg
$ 2,050.00
500 μg
$ 4,560.00
DispatchUsually dispatched within 1-2 weeks
Bulk Enquiry