You have no items in your shopping cart.
Mouse Cr2 protein
SKU: orb605207
Featured
Description
Images & Validation
−Item 1 of 2
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Tag | N-terminal 6xHis-Myc-tagged |
| Molecular Weight | 18.7 kDa |
| Expression Region | 12-145aa |
| Protein Length | Partial |
| Protein Sequence | ISCDPPPEVKNARKPYYSLPIVPGTVLRYTCSPSYRLIGEKAIFCISENQVHATWDKAPPICESVNKTISCSDPIVPGGFMNKGSKAPFRHGDSVTFTCKANFTMKGSKTVWCQANEMWGPTALPVCESDFPLE |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Disclaimer | For research use only |
Alternative Names
−Complement C3d receptor CD_antigen, CD21
Similar Products
−- Item 1 of 1
Mouse Cr2 protein [orb358517]
Greater than 90% as determined by SDS-PAGE.
28 kDa
Yeast
1 mg, 20 μg, 100 μg - Item 1 of 1
Mouse Cr2 protein [orb358564]
Greater than 90% as determined by SDS-PAGE.
30 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Mouse Cr2 protein [orb603990]
Greater than 90% as determined by SDS-PAGE.
18.1 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Mouse Cr2 protein [orb603991]
Greater than 90% as determined by SDS-PAGE.
18.7 kDa
E.coli
100 μg, 20 μg, 1 mg - Item 1 of 1
Cyclin-dependent kinase 6 Cdk6 Antibody [orb107626]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of Cr2 was greater than 90% as determined by SEC-HPLC
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Mouse Cr2 protein (orb605207)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 4-5 weeks