You have no items in your shopping cart.
Mouse Fgf9 protein
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is 4.14 ng/ml. |
| Tag | N-terminal 6xHis-tagged |
| Molecular Weight | 24.4 kDa |
| Expression Region | 1-208aa |
| Protein Length | Full Length |
| Protein Sequence | MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid |
| Buffer/Preservatives | 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, 5% Trehalose, 1 mM EDTA, 20% Glycerol, 1 mM DTT, pH 8.5 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−RecombinantFGF-9,Mouse [orb1494871]
> 95% as analyzed by SDS-PAGE and HPLC.
23.4 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
10 μg, 50 μg, 1 mgMouse FGF9 protein [orb754755]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
22.6 kDa
E.Coli
1 mg, 50 μg, 100 μg, 200 μgMouse FGF9 protein [orb707197]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
10 μg, 50 μg, 500 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Mouse Fgf9 protein (orb594767)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review