You have no items in your shopping cart.
Mouse IL-1 beta protein
SKU: orb1216263
Description
Images & Validation
−
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Mouse |
| Target | IL-1 beta |
| Molecular Weight | 17.4 kDa |
| Protein Length | 152.0 |
| Protein Sequence | VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS (152) |
| Purity | 98% |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−IL-1F2
Similar Products
−- Item 1 of 1
Mouse IL1B protein (Active) [orb359006]
> 96% as determined by SDS-PAGE and HPLC.
17.5 kDa
E.Coli
10 μg, 100 μg, 500 μg 
- Item 1 of 1
- Item 1 of 1
Mouse PTX3(Pentraxin 3, Long) Microsample ELISA Kit [orb2999238]
Mouse
0.16-10 ng/mL
0.071 ng/mL
48 T, 96 T Mouse IL-1R2 [orb3002218]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 39 KDa. Observed: 45-60 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
Gene Symbol
IL-1 beta
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Mouse IL-1 beta protein (orb1216263)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days