You have no items in your shopping cart.
Mouse IL17F Protein
SKU: orb426568
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Protein Sequence | RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA |
| Purity | Greater than 97.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Storage & Handling
−| Storage | Stability: Lyophilized Murine IL17F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17F should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | IL17F was lyophilized from a concentrated (1mg/ml) solution containing no additives. |
| Disclaimer | For research use only |
Alternative Names
−Cytokine ML-1, IL-17F, Interleukin-17F precursor, IL17F, ML1, ML-1.
Similar Products
−Recombinant Mouse IL17F Protein, N-His [orb2963683]
>90% as determined by SDS-PAGE.
18.00 kDa
1 mg, 100 μg, 50 μgMouse IL17F protein [orb707225]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgRecombinant Mouse IL-17F Protein, His Tag [orb1551197]
> 95% by SDS-PAGE.
Recombinant Mouse IL-17F Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (Met1-Ala161) of mouse IL-17F (Accession #NP_665855.2) fused with a 6��His Tag at the C-terminus.
100 μg, 50 μgRecombinant Mouse IL17F Protein, N-His [orb2831457]
>90% as determined by SDS-PAGE.
18 kDa
100 μg, 20 μg, 50 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Mouse IL17F Protein (orb426568)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days