Mouse IL33 protein (Active)

SKU: orb359021

Featured

Active

Description

This Mouse IL33 protein (Active) spans the amino acid sequence from region 109-266aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Images & Validation

−

Item 1 of 1

Application Notes	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

−

Source	E.Coli
Biological Origin	Mus musculus (Mouse)
Biological Activity	Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 0.5 ng/ml, corresponding to a specific activity of ＞ 2.0 × 106 IU/mg.
Tag	Tag-Free
Molecular Weight	17.5 kDa
Expression Region	109-266aa
Protein Length	Partial
Protein Sequence	SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
Purity	> 98% as determined by SDS-PAGE and HPLC.
Endotoxins	Less than 1.0 EU/µg as determined by LAL method.

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Lyophilized from a 0.2 µm filtered PBS, and 1 mM EDTA
Disclaimer	For research use only

Alternative Names

−

IL-33,; Interleukin-33109-266,]

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

UniProt

Q8BVZ5

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols

Peng Wang 1, Shuqi Yang 1, Changcheng Li 2, Baohua Ma 3, Mengqiu Yi 1, Xiaobo Chen 4, Min Yu Sulfotransferase homolog 2 receptors blockade on monocyte subsets along with their inflammatory cytokines for septic lung injury Exp Lung Res, (2024)

PubMed: 39243130