You have no items in your shopping cart.
Mouse Ngf protein
SKU: orb594762
Featured
Active
Description
Research Area
Neuroscience
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is 68.52 ng/ml. |
| Tag | Tag-Free |
| Molecular Weight | 12.4 kDa |
| Expression Region | 130-239aa |
| Protein Length | Partial |
| Protein Sequence | MGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATR |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 200mM NaCl, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Beta-Nerve Growth Factor; Beta-NGF; NGF; NGFB
Similar Products
−- Item 1 of 3
CD271 Mouse Monoclonal Antibody [orb1474046]
IF, IHC, WB
Human, Mouse
Mouse
Monoclonal
Unconjugated
200 μl, 100 μl, 50 μl, 30 μl - Item 1 of 1
Mouse Klk1b22 protein [orb358147]
Greater than 90% as determined by SDS-PAGE.
41.8 kDa
E.coli
1 mg, 20 μg, 100 μg 
- Item 1 of 1
Recombinant Mouse Beta-NGF Protein [orb3002316]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 12.4 KDa. Observed: 13 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Mouse Ngf protein (orb594762)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks