You have no items in your shopping cart.
Mouse RANTES protein (Active)
SKU: orb359106
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T lymphocytes is in a concentration range of 1.0-10 ng/ml. |
| Tag | Tag-Free |
| Molecular Weight | 7.9 kDa |
| Expression Region | 24-91aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS |
| Purity | > 97% as determined by SDS-PAGE and HPLC. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Beta chemokine RANTES protein, C C motif chemokine 5 protein, CCL 5 protein, CCL5 protein, Chemokine (C C motif) ligand 5 protein, Chemokine CC Motif Ligand 5 protein, EoCP protein, Eosinophil chemotactic cytokine protein, MGC17164 protein, RANTES(4-68) protein, Regulated upon activation normally T expressed and presumably secreted protein, SCYA 5 protein, SCYA5 protein, SIS delta protein, Small inducible cytokine A5 (RANTES) protein, Small-inducible cytokine A5 protein, T cell specific protein p288 protein, T cell specific RANTES protein protein, TCP228 protein
Similar Products
−Recombinant Murine Macrophage Inflammatory Protein-1 gamma/ CCL9/10 (rMuCCL9/10) [orb1494921]
>95% by SDS-PAGE and HPLC analyses.
Approximately 11.5 kDa, a single non-glycosylated polypeptide chain containing 101 amino acids.
Escherichia coli.
1 mg, 5 μg, 20 μgRecombinant Mouse C-C motif chemokine 5 protein(Ccl5) (Active) [orb1650791]
>97% as determined by SDS-PAGE and HPLC.
7.9 kDa
20 μg, 100 μg, 500 μg, 1 mg, 250 μg, 5 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Mouse RANTES protein (Active) (orb359106)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review