Mouse Rbp4 Protein

SKU: orb1477841

This product can be custom made

Featured

Active

Description

This Mouse Rbp4 Protein spans the amino acid sequence from region 19-201aa. Purity: Greater than 94% as determined by SDS-PAGE.

Research Area

Signal Transduction

Images & Validation

−

Item 1 of 2

Application Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

−

Source	Mammalian cell
Biological Origin	Mus musculus (Mouse)
Biological Activity	Measured by its binding ability in a functional ELISA. Immobilized Mouse Ttr at 5 μg/mL can bind Mouse Rbp4, the EC50 is 38.07-75.83 ng/mL.
Tag	C-terminal hFc1-tagged
Expression Region	19-201aa
Protein Length	Full Length of Mature Protein
Endotoxins	Less than 1.0 EU/μg as determined by LAL method.
MW	50.3 kDa
Purity	Greater than 94% as determined by SDS-PAGE.
Protein Sequence	ERDCRVSSFRVKENFDKARFSGLWYAIAKKDPEGLFLQDNIIAEFSVDEKGHMSATAKGRVRLLSNWEVCADMVGTFTDTEDPAKFKMKYWGVASFLQRGNDDHWIIDTDYDTFALQYSCRLQNLDGTCADSYSFVFSRDPNGLSPETRRLVRQRQEELCLERQYRWIEHNGYCQSRPSRNSL

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

(Plasma retinol-binding protein)(PRBP)(RBP)

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Mouse Ttr at 5 μg/ml can bind Mouse Rbp4, the EC50 is 38.07-75.83 ng/mL.

Quick Database Links

UniProt

Q00724

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols