Mouse SHH protein (Active)

SKU: orb359270

Featured

Description

This Mouse SHH protein (Active) spans the amino acid sequence from region 26-198aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Research Area

Cancer Biology

Images & Validation

−

Item 1 of 1

Application Notes	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

−

Source	E.Coli
Biological Origin	Mus musculus (Mouse)
Biological Activity	Fully biologically active when compared to standard. The ED50 as determined by inducing alkaline phosphatase production of murine C3H10T1/2 cells is 0.5 - 1.0 μg/ml.
Tag	Tag-Free
Molecular Weight	19.8 kDa
Expression Region	26-198aa
Protein Length	Partial
Protein Sequence	GPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
Purity	> 95% as determined by SDS-PAGE and HPLC.
Endotoxins	Less than 1.0 EU/μg as determined by LAL method.

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Lyophilized from a 0.2 µm filtered 20 mM PB, pH 7.4, 150mM NaCl
Disclaimer	For research use only

Alternative Names

−

SHH, ,; Sonic hedgehog protein C-product Sonic hedgehog protein 27 kDa product,],

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SDS-PAGE analysis of Mouse SHH protein (Active)

Quick Database Links

UniProt

Q62226

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols