Mouse TPO protein (Active)

SKU: orb359039

Featured

Active

Description

This Mouse TPO protein (Active) spans the amino acid sequence from region 22-195aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Images & Validation

−

Item 1 of 1

Application Notes	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

−

Source	E.Coli
Biological Origin	Mus musculus (Mouse)
Biological Activity	Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human MO7e cells is less than 1.0 ng/ml, corresponding to a specific activity of ＞ 1.0 × 106 IU/mg.
Tag	Tag-Free
Molecular Weight	18.7 kDa
Expression Region	22-195aa
Protein Length	Partial
Protein Sequence	SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTAVPSSTSQLLTLNKF
Purity	> 95% as determined by SDS-PAGE and HPLC.
Endotoxins	Less than 1.0 EU/µg as determined by LAL method.

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Lyophilized from a 0.2 µm filtered PBS, pH 7.4, with 5% Trehalose
Disclaimer	For research use only

Alternative Names

−

MSA protein, PERT_HUMAN protein, TDH2A protein, Thyroid microsomal antigen protein, Thyroid peroxidase protein, Thyroperoxidase protein, TPO protein, TPX protein

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

UniProt

P40226

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols