You have no items in your shopping cart.
MTUS1 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MTUS1 |
| Target | MTUS1 |
| Protein Sequence | Synthetic peptide located within the following region: KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR |
| Molecular Weight | 141kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−MTUS1 Rabbit Polyclonal Antibody [orb101286]
IF, IHC-Fr, IHC-P, WB
Bovine, Canine, Equine, Gallus, Human, Rabbit, Rat
Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlMTUS1 Rabbit Polyclonal Antibody [orb546346]
ELISA, ICC, IF, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μgMTUS1 Rabbit Polyclonal Antibody [orb579161]
WB
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Sample Type: HepG2, Antibody Dilution: 1.0 ug/ml. MTUS1 is strongly supported by BioGPS gene expression data to be expressed in HepG2.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

MTUS1 antibody - middle region (orb579162) validated by WB using MCF-7, HeLa, and human cancer cell lines at 1:2000.

MTUS1 antibody - middle region (orb579162) validated by WB using MCF-7, HeLa, and human cancer cell lines at 1:2000.

Rabbit Anti-MTUS1 Antibody, Catalog Number: orb579162, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasmic and membrane in cell bodies of pinealocytes and their processes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-MTUS1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Hela cell lysate. MTUS1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.
Quick Database Links
UniProt Details
−NCBI Reference Sequences
−| Protein | NP_001001924 |
|---|
Documents Download
Request a Document
Protocol Information
MTUS1 Rabbit Polyclonal Antibody (orb579162)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review






