You have no items in your shopping cart.
Neuropeptide EI-Gly-Arg-Arg-MCH (human, mouse, rat)
SKU: orb2694870
Description
Images & Validation
−
Key Properties
−| Molecular Weight | 4186.86 |
|---|---|
| Protein Sequence | EIGDEENSAKFPIGRRDFDMLRCMLGRVYRPCWQV(Disulfide bridge:C23-C32) |
| Purity | ≥95% |
Storage & Handling
−| Disclaimer | For research use only |
|---|
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Neuropeptide EI-Gly-Arg-Arg-MCH (human, mouse, rat) (orb2694870)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days