You have no items in your shopping cart.
NR1I2 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human NR1I2 |
| Target | NR1I2 |
| Protein Sequence | Synthetic peptide located within the following region: EVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGY |
| Molecular Weight | 50kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−PXR/NR1I2 Rabbit Polyclonal Antibody [orb570400]
ELISA, FC, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μgPXR Rabbit Polyclonal Antibody [orb6823]
FC, WB
Bovine, Equine, Porcine, Rat
Human, Mouse
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl, 200 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

Rabbit Anti-NR1I2 Antibody, Catalog Number: orb575749, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Nuclei in adipocytes but not in cardiomyocytes, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-NR1I2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate. NR1I2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.

WB Suggested Anti-NR1I2 antibody Titration: 1 ug/ml, Sample Type: Human heart.

WB Suggested Anti-NR1I2 antibody Titration: 1 ug/ml, Sample Type: Human liver.
Documents Download
Request a Document
Protocol Information
NR1I2 Rabbit Polyclonal Antibody (orb575749)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review




















