Cart summary

You have no items in your shopping cart.

NSP12 (SARS-CoV-2) Antibody

SKU: orb1463306

Description

Nsp12 is part of the multifunctional protein replicase polyprotein 1ab that is involved in the transcription and replication of viral RNA. This non-structural, RNA-directed RNA polymerase is responsible for replication and transcription of the viral RNA genome.

Images & Validation

Tested ApplicationsWB
Dilution RangeWB:1:500-1:2,000
ReactivityVirus
Application Notes
The antibody solution should be gently mixed before use.

Key Properties

HostGoat
ClonalityPolyclonal
IsotypeIgG
ImmunogenAntigen: Affinity purified recombinant fusion protein using the C-terminal of Nsp12 (residues 820 to stop) and produced in E. coli. Antigen Sequence: MPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYWEPEF YEAMYTPHTVLQ
PurificationEpitope affinity purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Form/AppearancePolyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
ConcentrationPlease inquire
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Nsp12 SARS Coronavirus-2, RNA-directed RNA polymerase antibody.

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

NSP12 (SARS-CoV-2) Antibody (orb1463306)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μg
$ 300.00
DispatchUsually dispatched within 2-3 days
Bulk Enquiry