Cart summary

You have no items in your shopping cart.

OMA1 Rabbit Polyclonal Antibody

SKU: orb581846

Description

Rabbit polyclonal antibody to OMA1

Research Area

Cell Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human OMA1
TargetOMA1
Protein SequenceSynthetic peptide located within the following region: WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA
Molecular Weight60 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

DAB1, MPRP1, MPRP-1, YKR087C, ZMPOMA1, peptidase, 2010001O09Rik

Similar Products

  • OMA1 Rabbit Polyclonal Antibody [orb312420]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Feline, Gallus, Porcine, Rabbit, Zebrafish

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • OMA1 Rabbit Polyclonal Antibody [orb629531]

    ELISA,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • Oma1 Rabbit Polyclonal Antibody [orb667553]

    WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl, 30 μl
  • OMA1 Rabbit Polyclonal Antibody (HRP) [orb2108681]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

    Rabbit

    Polyclonal

    HRP

    100 μl
  • OMA1 Rabbit Polyclonal Antibody (FITC) [orb2108682]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

    Rabbit

    Polyclonal

    FITC

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

OMA1 Rabbit Polyclonal Antibody

Sample Type: HepG2 cells, Primary dilution: 1:1000, Secondary Antibody: anti-Rabbit TBST with 5% BSA, Secondary dilution: 1:5000.

OMA1 Rabbit Polyclonal Antibody

Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 3 ug/ml.

OMA1 Rabbit Polyclonal Antibody

Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.

OMA1 Rabbit Polyclonal Antibody

Sample Tissue: Human Lung Tumor, Antibody dilution: 1 ug/ml.

OMA1 Rabbit Polyclonal Antibody

Positive control (+): 293T (2T), Negative control (-): Lung tumor (T-LU), Antibody concentration: 5 ug/ml.

OMA1 Rabbit Polyclonal Antibody

Lanes: Lane 1: 10 ug human fibroblast mitochondria, Lane 2: 15 ug fish embryo lysate; 6 h post fertilization, Lane 3: 30 ug fish embryo lysate, 6 days, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-Rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: OMA1.

OMA1 Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

OMA1 Rabbit Polyclonal Antibody

WB Suggested Anti-OMA1 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_660286

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

OMA1 Rabbit Polyclonal Antibody (orb581846)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry