You have no items in your shopping cart.
PARP2 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | ICC, IF, WB |
|---|---|
| Reactivity | Human, Rat |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PARP2 |
| Target | PARP2 |
| Protein Sequence | Synthetic peptide located within the following region: LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA |
| Molecular Weight | 66 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−PARP2 Rabbit Polyclonal Antibody [orb669239]
ELISA, FC, ICC, IF, WB
Human, Rat
Rabbit
Polyclonal
Unconjugated
100 μgPARP2 Rabbit Polyclonal Antibody [orb329743]
WB
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment. The peptide is within isoform at 66 kDa, 65 kDa, and 58 kDa, also modified by phosphorylation.

Sample Tissue: Human Hela, Antibody Dilution: 1.0 ug/mL.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/mL.

Sample Type: Rat thyrocytes-FRTL-5, Primary Antibody Dilution: 1:100, Secondary Antibody: Anti-rabbit-Texas Red, Secondary Antibody Dilution: 1:100, Color/Signal Descriptions: Red: PARP2 Blue: DAPI, Gene Name: PARP2.

WB Suggested Anti-PARP2 Antibody Titration: 0.2-1 ug/mL, Positive Control: Raji cell lysate, PARP2 is strongly supported by BioGPS gene expression data to be expressed in Human Raji cells.
Documents Download
Request a Document
Protocol Information
PARP2 Rabbit Polyclonal Antibody (orb329744)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review





