Cart summary

You have no items in your shopping cart.

Porcine IL-1 beta protein

SKU: orb1216291

Description

The Swine IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-1 beta Specifications: (Molecular Weight: 17.6 kDa) (Amino Acid Sequence: ANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP (153)) (Gene ID: 397122).

Images & Validation

Key Properties

SourceYeast
Biological OriginSwine
TargetIL-1 beta
Molecular Weight17.6 kDa
Protein Length153.0
Protein SequenceANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP (153)
Purity98%

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

IL-1F2

Similar Products

  • Porcine IL-1b protein [orb633356]

    ELISA,  WB

    Greater than 95% by SDS-PAGE gel analyses

    17.5 KDa

    E.Coli

    50 μg, 100 μg, 200 μg, 1 mg
  • Porcine IL 1 beta Protein [orb80409]

    Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.

    Escherichia Coli

    1 mg, 10 μg, 2 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Porcine IL-1 beta protein (orb1216291)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
$ 300.00
25 μg
$ 540.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry