You have no items in your shopping cart.
Porcine TNF alpha protein
SKU: orb1215718
Description
Images & Validation
−
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Swine |
| Target | TNF alpha |
| Molecular Weight | 16.9 kDa |
| Protein Length | 154.0 |
| Protein Sequence | SSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL |
| Purity | 98% |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−TNFSF2
Similar Products
−Porcine TNFA protein [orb633345]
ELISA, WB
Greater than 95% by SDS-PAGE gel analyses
17.2 KDa
E.Coli
50 μg, 100 μg, 200 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
Gene Symbol
TNF alpha
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Porcine TNF alpha protein (orb1215718)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review