Cart summary

You have no items in your shopping cart.

PPARGC1A Rabbit Polyclonal Antibody

SKU: orb330034

Description

Rabbit polyclonal antibody to PPARGC1A

Research Area

Cell Biology, Epigenetics & Chromatin, Immunology & Inflammation, Molecular Biology, Protein Biochemistry, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PPARGC1A
TargetPPARGC1A
Protein SequenceSynthetic peptide located within the following region: MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS
Molecular Weight91 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti LEM6 antibody, anti PGC-1(alpha) antibody, anti PGC-1v antibody, anti PGC1 antibody, anti PGC1A antibody, anti PPARGC1 antibody

Similar Products

  • PGC1 alpha + beta Rabbit Polyclonal Antibody [orb100963]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Mouse, Porcine, Rabbit

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PPARGC1A Rabbit Polyclonal Antibody [orb317701]

    ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Goat, Mouse, Porcine, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PPARGC1A Rabbit Polyclonal Antibody [orb1974626]

    ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Goat, Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • PPARGC1A Rabbit Polyclonal Antibody [orb329608]

    ICC,  IF,  WB

    Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Ppargc1a Rabbit Polyclonal Antibody [orb330035]

    WB

    Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

PPARGC1A Rabbit Polyclonal Antibody

25 ug of the indicated Mouse whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Recommended dilution for antibody is 1-3 ug/mL.

PPARGC1A Rabbit Polyclonal Antibody

Lanes: Lane 1: 30 ug Human liver, Lane 2: 30 ug Rat liver, Lane 3: 30 ug Mouse (wild-type) liver, Lane 4: 30 ug Mouse [AMPK alpha 1/2(-/-)] liver, Lane 5: 30 ug Human muscle, Lane 6: 30 ug Rat muscle, Lane 7: 30 ug Mouse muscle, Primary Antibody Dilution: 1:1000, Secondary Antibody Dilution: 1:10000, Gene Name: PPARGC1A.

PPARGC1A Rabbit Polyclonal Antibody

PPARGC1A antibody - N-terminal region (orb330034) validated by WB using Transfected Melanoma Cell at 1:1000.

PPARGC1A Rabbit Polyclonal Antibody

PPARGC1A antibody - N-terminal region (orb330034) validated by WB using transfected SH-SY5Y lysate at 1:15000.

PPARGC1A Rabbit Polyclonal Antibody

WB Suggested Anti-PPARGC1A Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: ACHN cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_037393

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

PPARGC1A Rabbit Polyclonal Antibody (orb330034)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry