You have no items in your shopping cart.
RAB1A Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RAB1A |
| Target | RAB1A |
| Protein Sequence | Synthetic peptide located within the following region: AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC |
| Molecular Weight | 23kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−RAB1A rabbit pAb Antibody [orb772990]
ELISA, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μlRAB1A Rabbit Polyclonal Antibody [orb630414]
ELISA, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μgRAB1A Rabbit Polyclonal Antibody [orb667868]
IF, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl, 200 μl, 30 μlRAB1A Rabbit Polyclonal Antibody [orb2952750]
ELISA, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Sample Type: 1. Human Cervical Cancer Cell Lysate (15 ug), 2. Monkey Fibroblast Cell Lysate (15 ug), 3. Human Cervical Cancer Cell transfected with Rab1A-GFP (15 ug), Primary dilution: 1:1000, Secondary Antibody: goat anti-Rabbit, Secondary dilution: 1:40000.

Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

Sample Tissue: Human 293T, Antibody dilution: 1.0 ug/ml.

Sample Type: 293T Whole cell lysates, Antibody dilution: 0.2 ug/ml.

Sample Type: HepG2, Antibody dilution: 1.0 ug/ml.

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2 ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%. RAB1A is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.

Rabbit Anti-RAB1A Antibody, Catalog Number: orb583215, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic in excellent staining, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-RAB1A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Muscle.
Documents Download
Request a Document
Protocol Information
RAB1A Rabbit Polyclonal Antibody (orb583215)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review






