You have no items in your shopping cart.
Rabbit polyclonal antibodies to CD4
Description
Images & Validation
−| Tested Applications | ELISA, WB |
|---|---|
| Dilution Range | Western blot: 0.1-1.0 µg/ml |
| Reactivity | Human |
Key Properties
−| Antibody Type | Primary Antibody |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG/IgM |
| Immunogen | IGLGIFFCVRCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI - αα 412-458 |
| Target | CD4 |
| Molecular Weight | 51 111 |
| Purification | Immunogen affinity column |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Form/Appearance | Liquid |
| Buffer/Preservatives | Glycine pH 7.2 |
| Concentration | Batch dependent within range 2.0-2.5 mg/mL |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Western blot demonstrating our polyclonal detecting recombinant human CD4 (P01730) at 1 in 2000 dilution. Lane 1: Marker; Lane 2: CD4 (1ng); Lane 3: CD4 (5ng); Lane 4: CD4 (10ng); Lane 5: CD4 (50ng).

ELISA Plates were coated with 1 µg/mL recombinant human CD4 protein, our polyclonal anti-CD4 was added at different concentrations and detected with an anti-rabbit HRP.
Quick Database Links
UniProt Details
−NCBI Reference Sequences
−| Protein | NP_000607.1 |
|---|
Documents Download
Request a Document
Protocol Information
Rabbit polyclonal antibodies to CD4 (orb2284540)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review