Rat D4A875 protein (Active)

SKU: orb359131

Featured

Description

This Rat D4A875 protein (Active) spans the amino acid sequence from region 23-119aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Research Area

Immunology & Inflammation

Images & Validation

−

Item 1 of 1

Application Notes	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

−

Source	E.Coli
Biological Origin	Rattus norvegicus (Rat)
Biological Activity	Fully biologically active when compared to standard. The ED50 as determined by its ability to induce VEGF expression using murine endothelial cells is less than 5.0 μg/ml, corresponding to a specific activity of ＞ 200 IU/mg
Tag	Tag-Free
Molecular Weight	11.5 kDa
Expression Region	23-119aa
Protein Length	Full Length of Mature Protein
Protein Sequence	SPNQEVARHHGDQHQAPRRWLWEGGQECDCKDWSLRVSKRKTTAVLEPPRKQCPCDHVKGSEKKNRRQKHHRKSQRPSRTCQQFLKRCQLASFTLPL
Purity	> 97% as determined by SDS-PAGE and HPLC.
Endotoxins	Less than 1.0 EU/μg as determined by LAL method.

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Lyophilized from a 0.2 µm filtered PBS, pH 7.4
Disclaimer	For research use only

Alternative Names

−

RGD1304717_predicted

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SDS-PAGE analysis of Rat D4A875 protein (Active)

Quick Database Links

UniProt

D4A875

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols