You have no items in your shopping cart.
Rat UTER protein (Active)
SKU: orb359244
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Rattus norvegicus (Rat) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by the ability of the immobilized protein to support the adhesion of the A549 human lung carcinoma cells is less than 5.0 μg/ml, corresponding to a specific activity of > 200 IU/m. |
| Tag | Tag-Free |
| Molecular Weight | 8.5 kDa |
| Expression Region | 20-96aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | SSDICPGFLQVLEALLLGSESNYEAALKPFNPASDLQNAGTQLKRLVDTLPQETRINIVKLTEKILTSPLCEQDLRV |
| Purity | > 97% as determined by SDS-PAGE and HPLC. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered 20 mM PB, pH 7.4, 150mM NaCl |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Clara cell phospholipid-binding protein, Clara cells 10 kDa secretory protein, CC10, PCB-binding protein, Secretoglobin family 1A member 1

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Rat UTER protein (Active) (orb359244)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review