You have no items in your shopping cart.
Recombinant Bovine Fibroblast growth factor 2 (FGF2) (Active)
SKU: orb2657927
Featured
Active
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Bos taurus (Bovine) |
| Biological Activity | Measured in a cell proliferation assay using NIH3T3 mouse embryonic fibroblast cells. The ED50 for this effect is ≤2.0 ng/mL |
| Tag | Tag free |
| Molecular Weight | 16.5 kDa |
| Expression Region | 10-155aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | ≤200 EU/mg by the LAL method |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution containing 10mMPB, 250mMNaCl,5%mannitol and 0.01% Tween 80 ,pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; FGF2; FGFB
Similar Products
−Recombinant Bovine Fibroblast growth factor 2 (FGF2) (Active) [orb2658712]
Greater than 95% as determined by SDS-PAGE.
16.5 kDa
E.coli
20 μg, 1 mg, 100 μgRecombinant bovine bFGF/FGF-2 protein (Active, E.coli) [orb2978620]
≥ 95% as determined by SDS-PAGE.
16.5 kDa
500 μg, 50 μg, 10 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Bovine Fibroblast growth factor 2 (FGF2) (Active) (orb2657927)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review