You have no items in your shopping cart.
Recombinant Dog CD40 ligand (CD40LG)
SKU: orb2902774
Description
Research Area
Immunology & Inflammation
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | in vitro E.coli expression system |
|---|---|
| Biological Origin | Canis lupus familiaris (Dog) (Canis familiaris) |
| Tag | N-terminal 10xHis-tagged |
| Molecular Weight | 30.2 kDa |
| Expression Region | 1-260aa |
| Protein Length | Full Length |
| Protein Sequence | MIETYSQTAPRSVATGPPVSMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLYEDFVFMKTLQKCNKGEGSLSLLNCEEIKSQFEAFLKEIMLNNEMKKEENIAMQKGDQDPRIAAHVISEASSNPASVLRWAPKGYYTISSNLVSLENGKQLAVKRQGLYYVYAQVTFCSNRAASSQAPFVASLCLHSPSGTERVLLRAASSRGSSKPCGQQSIHLGGVFELHPGASVFVNVTDPSQVSHGTGFTSFGLLKL |
| Purity | Greater than 85% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Disclaimer | For research use only |
Alternative Names
−Tumor necrosis factor ligand superfamily member 5
Similar Products
−Recombinant Dog CD154/CD40LG/TNFSF5 Protein, C-His [orb2963082]
>90% as determined by SDS-PAGE.
16.67 kDa
1 mg, 100 μg, 50 μgRecombinant Dog CD154/CD40LG/TNFSF5 Protein, C-Fc [orb2963302]
>90% as determined by SDS-PAGE.
44.04 kDa
1 mg, 100 μg, 50 μgRecombinant Dog CD154/CD40LG/TNFSF5 Protein, N-His [orb2963322]
>90% as determined by SDS-PAGE.
18.00 kDa
1 mg, 100 μg, 50 μgRecombinant Dog CD154/CD40LG/TNFSF5 Protein, C-His [orb2831330]
>90% as determined by SDS-PAGE.
16.67 kDa
20 μg, 100 μg, 50 μgRecombinant Dog CD154/CD40LG/TNFSF5 Protein, C-Fc [orb2831380]
>90% as determined by SDS-PAGE.
44.04 kDa
20 μg, 50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Dog CD40 ligand (CD40LG) (orb2902774)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review