You have no items in your shopping cart.
Recombinant FGF-17 (Fibroblast growth factor-17), Human, Animal-Free
SKU: orb1179122
Description
Images & Validation
−
| Tested Applications | Cell Culture, ELISA |
|---|
Key Properties
−| Source | Escherichia coli |
|---|---|
| Expression System | Escherichia coli |
| Biological Origin | Human |
| Biological Activity | Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <5 ng/mL. The specific activity of recombinant human FGF-17 is > 2 x 105 IU/mg. |
| Reactivity | Human |
| Tag | His-tag at the N-terminus |
| Protein Sequence | TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT with polyhistidine tag at the N-terminus. |
| Purity | >98% as determined by SDS-PAGE. Ni-NTA chromatography. |
| Endotoxins | <0.1 EU per 1 μg of the protein by the LAL method. |
Storage & Handling
−| Storage | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
|---|---|
| Form/Appearance | Lyophilized |
| Buffer/Preservatives | The protein was lyophilized from a solution containing 1X PBS, pH 8.0. |
| Reconstitution | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−FGFH

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Documents Download
Datasheet
Product Information
Request a Document
Recombinant FGF-17 (Fibroblast growth factor-17), Human, Animal-Free (orb1179122)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review