You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 10xHis-HA-tagged |
| Expression Region | 24-96aa |
| Protein Length | Full Length of Mature Protein |
| MW | 12.3 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human CCL1 Protein [orb1471777]
Unconjugated
Greater than 95% as determined by reducing SDS-PAGE.
8.62 KDa
Mammalian
10 μg, 50 μgRecombinant Human C-C motif chemokine 1 (CCL1) [orb1095951]
Greater than 85% as determined by SDS-PAGE.
11.1 kDa
E.coli
20 μg, 100 μg, 1 mgRecombinant Human C-C motif chemokine 1 (CCL1) [orb1095952]
Greater than 85% as determined by SDS-PAGE.
12.6 kDa
E.coli
20 μg, 100 μg, 1 mgRecombinant Human CCL1 Protein [orb3002330]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 8.62 KDa. Observed: 10 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human CCL1/I-309 Protein, N-GST [orb2968904]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
35.31 kDa
1 mg, 50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Human C-C motif chemokine 1 (CCL1) (orb2659603)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review


