Recombinant Human C-type lectin domain family 4 member C (CLEC4C), partial (Active)

SKU: orb1742790

Featured

Description

This Recombinant Human C-type lectin domain family 4 member C (CLEC4C), partial (Active) spans the amino acid sequence from region 45-213aa. Purity: Greater than 95% as determined by SDS-PAGE

Images & Validation

−

Item 1 of 2

Application Notes	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

−

Source	Mammalian cell
Biological Origin	Homo sapiens (Human)
Biological Activity	Measured by its binding ability in a functional ELISA. Immobilized Human CLEC4C at 2 μg/mL can bind Anti-CLEC4C recombinant antibody. The EC50 is 7.658-12.99 ng/mL
Tag	N-terminal 6xHis-Myc-tagged
Molecular Weight	24.1 kDa
Expression Region	45-213aa
Protein Length	Partial
Protein Sequence	NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI; Expression Region: 45-213aa
Purity	Greater than 95% as determined by SDS-PAGE
Endotoxins	Less than 1.0 EU/ug as determined by LAL method

Storage & Handling

−

Storage	Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Disclaimer	For research use only

Alternative Names

−

Blood dendritic cell antigen 2; BDCA-2; C-type lectin superfamily member 7; Dendritic lectin; CD303; CLEC4C; BDCA2; CLECSF11; CLECSF7; DLEC; HECL

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Recombinant Human C-type lectin domain family 4 member C (CLEC4C), partial (Active)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Human CLEC4C at 2μg/mL can bind Anti-CLEC4C recombinant antibody, the EC50 is 7.658-12.99 ng/mL.

Quick Database Links

UniProt

Q8WTT0

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

MSDS

Safety Data Sheet

Download

Request a Document

Protocol Information

Find More Protocols