Cart summary

You have no items in your shopping cart.

Recombinant Human CD79A&CD79B Heterodimer Protein (Active)

SKU: orb2986827
ActiveBiologically Active

Description

This Recombinant Human CD79A&CD79B Heterodimer Protein (Active) spans the amino acid sequence from region 33-143aa&29-159aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Immunology & Inflammation

Images & Validation

Application Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

SourceMammalian cell
Biological OriginHomo sapiens (Human)
Biological Activity①Measured by its binding ability in a functional ELISA. Immobilized Human CD79A&CD79B at 2 μg/mL can bind Anti-CD79A recombinant antibody. The EC50 is 8.012-9.339 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Human CD79A&CD79B at 2 μg/mL can bind Anti-CD79B recombinant antibody. The EC50 is 14.85-17.47 ng/mL.
TagC-terminal mFc-Flag-tagged&C-terminal 10xHis-mFC-tagged
Molecular Weight41.3 kDa&43.1 kDa
Expression Region33-143aa&29-159aa
Protein LengthHeterodimer
Protein SequenceLWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR&ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD
PurityGreater than 90% as determined by SDS-PAGE.
EndotoxinsLess than 1.0 EU/μg as determined by LAL method.

Storage & Handling

StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

/
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

UniProt Details

No UniProt data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Recombinant Human CD79A&CD79B Heterodimer Protein (Active) (orb2986827)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

20 μg
$ 210.00
100 μg
$ 390.00
1 mg
$ 2,820.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry