Recombinant Human Claudin-6 (CLDN6)-Detergent (Active)

SKU: orb2658573

Featured

Description

This Recombinant Human Claudin-6(CLDN6)-Detergent (Active) spans the amino acid sequence from region 2-220aa. Purity: Greater than 90% as determined by SDS-PAGE.

Images & Validation

−

Item 1 of 3

Application Notes	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

−

Source	Mammalian cell
Biological Origin	Homo sapiens (Human)
Biological Activity	Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/mL on an Nickel Coated plate can bind Anti-CLDN6/9 recombinant antibody. The EC50 is 0.6949-1.158 ng/mL.
Tag	N-terminal 10xHis-tagged and C-terminal Twin-Strep-tagged
Molecular Weight	27.7 kDa
Expression Region	2-220aa
Protein Length	Full Length
Protein Sequence	ASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
Purity	Greater than 90% as determined by SDS-PAGE.
Endotoxins	Less than 1.0 EU/μg as determined by LAL method.

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Lyophilized from a 0.2 μm sterile filtered DDM/CHS, 50 mM HEPES, 150 mM NaCl, 6% Trehalose, pH 7.5.
Disclaimer	For research use only

Alternative Names

−

UNQ757; PRO1488

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Recombinant Human Claudin-6 (CLDN6)-Detergent (Active)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/ml on an Nickel Coated plate can bind Anti-CLDN6/9 recombinant antibody. The EC50 is 0.6949-1.158 ng/mL.

Human CLDN6 Monoclonal Antibody captured on Protein A Chip can bind Human CLDN6 Full Length Protein with an affinity constant of 5.43 nM as detected by MetaSPR Assay (in presence of DDM/CHS) (WeSPRTM200).

Quick Database Links

UniProt

P56747

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols