You have no items in your shopping cart.
Recombinant Human COL3A1 Protein
SKU: orb3068371
Description
Images & Validation
−
Key Properties
−| Source | Komagataella phaffii |
|---|---|
| Target | COL3A1 |
| Reactivity | Human |
| Protein Sequence | AGNTGAPGSPGVSGPKGDAGQPGEKGSPGAQGPPGAPGPLGIAGITGARGLAGPPGMPGPRGSPGPQGVKGESGKPGANGLSGERGPPGPQGLPGLAGTAGEPGRDGNPGSDGLPGRDGSPGGKGDRGENGSPGAPGAPGHPGPPGPVGPAGKSGDRGESGPAGPAGAPGPAGSRGAPGPQGPRGDKGETGERGAAGIKGHRGFPGNPGAPGSPGPAGQQGAIGSPGPAGPRGPVGPSGPPGKDGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAAGNTGAPGSPGVSGPKGDAGQPGEKGSPGAQGPPGAPGPLGIAGITGARGLAGPPGMPGPRGSPGPQGVKGESGKPGANGLSGERGPPGPQGLPGLAGTAGEPGRDGNPGSDGLPGRDGSPGGKGDRGENGSPGAPGAPGHPGPPGPVGPAGKSGDRGESGPAGPAGAPGPAGSRGAPGPQGPRGDKGETGERGAAGIKGHRGFPGNPGAPGSPGPAGQQGAIGSPGPAGPRGPVGPSGPPGKDGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAHHHHHH |
| Purity | Greater than 90% as determined by reducing SDS-PAGE. |
| Endotoxins | Less than 0.05 EU/mg as determined by LAL test. |
Storage & Handling
−| Storage | Store it at -20°C to -80°C for two years. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
|---|---|
| Form/Appearance | Liquid |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Collagen alpha-1(III) chain
Similar Products
−Recombinant Human PIIICP/COL3A1 Protein, N-His-SUMO [orb2963475]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
46.63 kDa
1 mg, 50 μg, 100 μgRecombinant Human PIIINP/COL3A1 Protein, N-His [orb2961539]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
15.54 kDa
1 mg, 50 μg, 100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Human COL3A1 Protein (orb3068371)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days