Recombinant Human Fibroblast Growth Factor- acidic (rHuaFGF )

SKU: orb1495079

Description

FGF acidic, also known as FGF-1 and endothelial cell growth factor, is a member of the FGF family of mitogenic peptides which currently is comprised of at least seven proteins which show 35-55% amino acid sequence conservation. FGF acidic and basic, unlike the other members of the family, lack signal peptides and are apparently secreted by mechanisms other than the classical protein secretion pathway. FGF acidic has been detected in large amounts in the brain. Other cells known to express FGF acidic include hepatocytes, vascular smooth muscle cells, CNS neurons, skeletal muscle cells, fibroblasts, keratinocytes, endothelial cells, intestinal columnar epithelium cells and pituitary basophils and acidophils. As with other FGF’s, FGF acidic exhibits considerable species crossreactivity. FGF acidic and FGF basic stimulate the proliferation of all cells of mesodermal origin, and many cells of neuroectodermal, ectodermal and endodermal origin.

Images & Validation

−

Application Notes	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions. Read more...

Key Properties

−

Source	Escherichia coli.
Biological Activity	Fully biologically active when compared to standard. The ED50, calculated by the dose-dependant proliferation of BAF3 cells expressing FGF receptors (measured by 3H-thymidine uptake) is less than 10 ng/ml, corresponding to a specific activity of ≥ 1×105 units/mg.
Molecular Weight	Approximately 15.8 kDa, a single non-glycosylated polypeptide chain containing 140 amino acids.
Protein Sequence	MFNLPPGNYK KPKLLYCSNG GHFLRILPDG TVDGTRDRSD QHIQLQLSAE SVGEVYIKST ETGQYLAMDTDGLLYGSQTPNEECLFLERL EENHYNTYIS KKHAEKNWFV GLKKNGSCKR GPRTHYGQKA ILFLPLPVSS D
Purification	>95% by SDS-PAGE and HPLC analyses.
Purity	>95% by SDS-PAGE and HPLC analyses.
Endotoxins	Less than 1EU/mg of rHu aFGF as determined by LAL method.

Storage & Handling

−

Storage	This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
Form/Appearance	Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
Buffer/Preservatives	Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols