Recombinant Human G-protein coupled receptor 20 (GPR20)-VLPs (Active)

SKU: orb2658866

Featured

Description

This Recombinant Human G-protein coupled receptor 20 (GPR20)-VLPs (Active) spans the amino acid sequence from region 1-358aa. Purity: The purity information is not available for VLPs proteins.

Images & Validation

−

Item 1 of 2

Application Notes	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Key Properties

−

Source	Mammalian cell
Biological Origin	Homo sapiens (Human)
Biological Activity	Measured by its binding ability in a functional ELISA. Immobilized Human GPR20 at 10 μg/mL can bind Anti-GPR20 recombinant antibody. The EC50 is 2.431 - 3.239 ng/mL. The VLPs is negative control.
Tag	C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
Molecular Weight	40.0 kDa
Expression Region	1-358aa
Protein Length	Full Length
Protein Sequence	MPSVSPAGPSAGAVPNATAVTTVRTNASGLEVPLFHLFARLDEELHGTFPGLWLALMAVHGAIFLAGLVLNGLALYVFCCRTRAKTPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLRCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGVTGSRPCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLHQGRQRRVRAMQLLLTVLIIFLVCFTPFHARQVAVALWPDMPHHTSLVVYHVAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFGQHGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGPEA
Purity	The purity information is not available for VLPs proteins.
Endotoxins	Less than 1.0 EU/μg as determined by LAL method.

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Recombinant Human G-protein coupled receptor 20 (GPR20)-VLPs (Active)

Detected by Mouse anti-6*His monoclonal antibody. (This tag can be tested only under denaturing conditions.)

Measured by its binding ability in a functional ELISA. Immobilized Human GPR20 at 10 μg/ml can bind Anti-GPR20 recombinant antibody. The EC50 is 2.431 - 3.239 ng/mL.The VLPs is negative control.

Quick Database Links

UniProt

Q99678

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols