You have no items in your shopping cart.
Recombinant Human G-protein coupled receptor 20 (GPR20)-VLPs (Active)
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human GPR20 at 10 μg/mL can bind Anti-GPR20 recombinant antibody. The EC50 is 2.431 - 3.239 ng/mL. The VLPs is negative control. |
| Tag | C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions) |
| Molecular Weight | 40.0 kDa |
| Expression Region | 1-358aa |
| Protein Length | Full Length |
| Protein Sequence | MPSVSPAGPSAGAVPNATAVTTVRTNASGLEVPLFHLFARLDEELHGTFPGLWLALMAVHGAIFLAGLVLNGLALYVFCCRTRAKTPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLRCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGVTGSRPCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLHQGRQRRVRAMQLLLTVLIIFLVCFTPFHARQVAVALWPDMPHHTSLVVYHVAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFGQHGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGPEA |
| Purity | The purity information is not available for VLPs proteins. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Detected by Mouse anti-6*His monoclonal antibody. (This tag can be tested only under denaturing conditions.)

Measured by its binding ability in a functional ELISA. Immobilized Human GPR20 at 10 μg/ml can bind Anti-GPR20 recombinant antibody. The EC50 is 2.431 - 3.239 ng/mL.The VLPs is negative control.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Human G-protein coupled receptor 20 (GPR20)-VLPs (Active) (orb2658866)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review