You have no items in your shopping cart.
Recombinant Human Growth hormone receptor (GHR), partial, Biotinylated (Active)
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized human GH1 at 2 μg/ml can bind Biotinylated human GHR, the EC50 is 2.067-3.208 ng/ml. |
| Tag | C-terminal mFc-Avi-tagged |
| Molecular Weight | 56.6 kDa |
| Expression Region | 27-264aa |
| Protein Length | Partial |
| Protein Sequence | AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized human GH1 at 2 μg/ml can bind Biotinylated human GHR, the EC50 is 2.067-3.208 ng/ml.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Human Growth hormone receptor (GHR), partial, Biotinylated (Active) (orb1095891)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review