Recombinant Human Hematopoietic progenitor cell antigen CD34(CD34)

SKU: orb2902558

Description

This Recombinant Human Hematopoietic progenitor cell antigen CD34(CD34) spans the amino acid sequence from region 32-385.

Images & Validation

−

Key Properties

−

Biological Origin	Homo sapiens (Human)
Expression Region	32-385
Protein Length	full length protein
Protein Sequence	SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL

Storage & Handling

−

Storage	Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Disclaimer	For research use only

Alternative Names

−

Hematopoietic progenitor cell antigen CD34, CD_antigen= CD34

Mouse CD34 Protein, hFc Tag [orb1290854]

Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 53.3 kDa after removal of the signal peptide. The apparent molecular mass of mCD34-hFc is approximately 70-100 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 50 μg, 100 μg, 10 μg

Recombinant Human CD34 Protein, C-Fc [orb2964891]
Purity:
>90% as determined by SDS-PAGE.
MW:
57.28 kDa
Sizes Available: 1 mg, 100 μg, 50 μg
Human CD34 protein [orb754407]
Applications:
ELISA, WB
Purity:
Greater than 95% as determined by SDS-PAGE
MW:
28.4 kDa
Source:
E.Coli
Sizes Available: 200 μg, 100 μg, 50 μg, 1 mg
Recombinant Human CD34 Protein, C-Fc [orb2821152]
Purity:
>90% as determined by SDS-PAGE.
MW:
57.28 kDa
Sizes Available: 50 μg, 20 μg, 100 μg

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

UniProt

P28906

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols