You have no items in your shopping cart.
Recombinant Human IL8 Protein
Description
Images & Validation
−
| Tested Applications | ELISA, MS, SDS-PAGE, WB |
|---|---|
| Application Notes |
Key Properties
−| Source | E. coli |
|---|---|
| Reactivity | Human |
| Protein Sequence | ELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVE |
| Purity | Greater than 95% as determined by RP-HPLC and reducing SDS-PAGE. |
Storage & Handling
−| Storage | Store it at -20°C to -80°C for one year. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
|---|---|
| Form/Appearance | Liquid in a 0.2 μm filtered solution of PBS, pH 7.4. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human IL8 Protein, hFc Tag [orb1291089]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 34.5 kDa after removal of the signal peptide. The apparent molecular mass of hFc-IL8 is approximately 35-55 kDa due to glycosylation.
Mammalian
50 μg, 10 μg, 100 μgGPER Antibody [orb666812]
IF, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 50 μl, 100 μl, 200 μlHuman IL-8 [orb3002355]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 8.9 KDa. Observed: 11 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgHuman IL-8 [orb3002402]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 8.45 KDa. Observed: 10 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Documents Download
Request a Document
Protocol Information
Recombinant Human IL8 Protein (orb3068369)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review





