You have no items in your shopping cart.
Recombinant Human IL8 Protein
SKU: orb3068369
Description
Images & Validation
−
| Tested Applications | ELISA, MS, SDS-PAGE, WB |
|---|---|
| Application Notes |
Key Properties
−| Source | E. coli |
|---|---|
| Reactivity | Human |
| Protein Sequence | ELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVE |
| Purity | Greater than 95% as determined by RP-HPLC and reducing SDS-PAGE. |
Storage & Handling
−| Storage | Store it at -20°C to -80°C for one year. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
|---|---|
| Form/Appearance | Liquid in a 0.2 μm filtered solution of PBS, pH 7.4. |
| Disclaimer | For research use only |
Alternative Names
−CXCL8; Interleukin-8; IL-8; C-X-C motif chemokine 8; Emoctakin; Granulocyte chemotactic protein 1; GCP-1; Monocyte-derived neutrophil chemotactic factor; MDNCF; Monocyte-derived neutrophil-activating peptide; MONAP; Neutrophil-activating protein 1; NAP-1; Protein 3-10C; T-cell chemotactic factor
Similar Products
−- Item 1 of 3
- Item 1 of 2
Human IL8 Protein, hFc Tag [orb1291089]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 34.5 kDa after removal of the signal peptide. The apparent molecular mass of hFc-IL8 is approximately 35-55 kDa due to glycosylation.
Mammalian
50 μg, 10 μg, 100 μg - Item 1 of 2
GPER Antibody [orb666812]
IF, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 50 μl, 100 μl, 200 μl Human IL-8 [orb3002355]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 8.9 KDa. Observed: 11 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgHuman IL-8 [orb3002402]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 8.45 KDa. Observed: 10 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
WB
Western Blot (IB, immunoblot)
ELISA
Enzyme-linked Immunosorbent Assay (EIA)
SDS-PAGE
Sodium Dodecyl Sulphate PolyAcrylamide Gel Electrophoresis
Recombinant Human IL8 Protein (orb3068369)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days