You have no items in your shopping cart.
Recombinant Human Interferon gamma (IFNG) (Active)
SKU: orb2986506
Description
Research Area
Immunology & Inflammation
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human IFNG at 2 μg/mL can bind anti-IFNG recombinant antibody. The EC50 is 74.23-96.56 ng/mL. |
| Tag | C-terminal 10xHis-tagged |
| Molecular Weight | 18.2 kDa |
| Expression Region | 24-166aa |
| Protein Length | Full Length |
| Protein Sequence | QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Disclaimer | For research use only |
Alternative Names
−Interferon gamma; IFN-gamma; Immune interferon; IFNG
Similar Products
−Recombinant Human Interferon gamma (IFNG) (Active) [orb2657935]
Greater than 95% as determined by SDS-PAGE.
16.8 kDa
Mammalian cell
1 mg, 50 μg, 10 μgRecombinant human IFNγ protein (Active, E.coli) [orb2978602]
≥ 95% as determined by SDS-PAGE.
16.8 kDa
500 μg, 50 μg, 10 μgRecombinant human IFNγ protein (Active, CHO) [orb2978603]
≥ 95% as determined by SDS-PAGE.
16.8 kDa
500 μg, 50 μg, 10 μgRecombinant Human Interferon gamma protein(IFNG) (Active) [orb1650688]
>98% as determined by SDS-PAGE and HPLC.
16.9 kDa
20 μg, 100 μg, 500 μg, 250 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Human Interferon gamma (IFNG) (Active) (orb2986506)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review