You have no items in your shopping cart.
Recombinant Human Interleukin-15 (IL15)
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-tagged |
| Molecular Weight | 16.8 kDa |
| Expression Region | 49-162aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human IL15 Protein, hFc Tag [orb1291067]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 38.9 kDa after removal of the signal peptide. The apparent molecular mass of IL15-hFc is approximately 35-55kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μgHuman IL-15RA&IL-15 [orb3002349]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. (QC verified)
Predicted: 34.4&12.8 KDa. Observed: 37&17 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgHuman IL-15 [orb3002492]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 12.5 KDa. Observed: 12 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgHuman IL-15RA&IL-15 [orb3002427]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 46.9 KDa. Observed: 50-60 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Human Interleukin-15 (IL15) (orb1096593)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review



