You have no items in your shopping cart.
Recombinant Human Interleukin-21 (IL21) (Active)
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its ability to enhance IFN-gamma secretion in NK-92 human natural killer lymphoma cells. The ED50 for this effect is ≤ 20 ng/mL. |
| Tag | C-terminal hFc1-tagged |
| Molecular Weight | 41.9 kDa |
| Expression Region | 25-162aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | HKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | ≤10 EU/mg by the LAL method |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution containing PBS,5% mannitoland 0.01% Tween 80, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant human IL-21 protein, C-hFc (Active, CHO) [orb2978624]
≥ 95% as determined by SDS-PAGE.
41.9 kDa
10 μg, 50 μg, 500 μgRecombinant human IL-21 protein (Active, CHO) [orb2978625]
≥ 95% as determined by SDS-PAGE.
15.9 kDa
50 μg, 500 μg, 10 μgRecombinant human IL-22 protein (Active, CHO) [orb3124210]
≥ 95% as determined by SDS-PAGE.
16.5 kDa
500 μg, 50 μg, 10 μgRecombinant Human Interleukin-21 (IL21) (Active) [orb2657888]
Greater than 95% as determined by SDS-PAGE.
15.9 kDa
Mammalian cell
1 mg, 50 μg, 10 μgRecombinant Human Interleukin-21 protein(IL21) (Active) [orb1650649]
>97% as determined by SDS-PAGE and HPLC.
15.4 kDa
100 μg, 500 μg, 1 mg, 250 μg, 10 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Human Interleukin-21 (IL21) (Active) (orb2657887)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review