You have no items in your shopping cart.
Recombinant Human Interleukin-1 receptor-like 1 (IL1RL1), partial (Active)
SKU: orb2985919
Description
Research Area
Cardiovascular Research
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | ①Measured by its binding ability in a functional ELISA.Immobilized Human IL1RL1 at 2 μg/mL can bind Anti-IL1RL1 recombinant antibody(CSB-RA011626MA1HU). The EC50 is 6.366-7.698 ng/mL. ②Measured by its binding ability in a functional ELISA.Immobilized Human IL1RL1 at 2 μg/mL can bind Anti-IL1RL1 recombinant antibody(CSB-RA011626MA2HU). The EC50 is 11.85-13.96 ng/mL. |
| Tag | C-terminal 10xHis-tagged |
| Molecular Weight | 35.8 kDa |
| Expression Region | 19-323aa |
| Protein Length | Partial |
| Protein Sequence | KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNP |
| Purity | Greater than 95% as determined by SDS-PAGE. Greater than 95% as determined by SEC-HPLC. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Disclaimer | For research use only |
Alternative Names
−Interleukin-1 receptor-like 1; EC:3.2.2.6; Protein ST2; IL1RL1; DER4, ST2, T1

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Human Interleukin-1 receptor-like 1 (IL1RL1), partial (Active) (orb2985919)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review