You have no items in your shopping cart.
Recombinant Human Interleukin-23 subunit alpha (IL23A)
SKU: orb2986307
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | C-terminal 10xHis-HSA-tagged |
| Molecular Weight | 86.8 kDa |
| Expression Region | 20-189aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP |
| Purity | Greater than 85% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−IL-23 subunit alpha;IL-23-A;Interleukin-23 subunit p19;IL-23p19
Similar Products
−Recombinant human IL-23 protein (Active, HEK293) [orb1817197]
>95% as determined by SDS-PAGE
60 kDa
10 μg, 50 μgRecombinant Human IL23A Protein, C-His [orb2961437]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
21.68 kDa
1 mg, 50 μg, 100 μgRecombinant Human IL23A Protein, N-His [orb2961438]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
20.97 kDa
1 mg, 50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Human Interleukin-23 subunit alpha (IL23A) (orb2986307)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review


