You have no items in your shopping cart.
Recombinant Human Interleukin-1 beta (IL1B) (Active)
SKU: orb2986450
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA.Immobilized Human IL1B at 5 μg/mL can bind Human IL1R2(CSB-MP011622HU1). The EC50 is 89.65-100.5 ng/mL. |
| Tag | N-terminal 10xHis-tagged |
| Molecular Weight | 21.0 kDa |
| Expression Region | 117-269aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Interleukin-1 beta; IL-1 beta; Catabolin; IL1B; IL1F2
Similar Products
−Recombinant human IL-1b protein (Active, HEK293) [orb1817211]
>95% as determined by SDS-PAGE
18-25 kDa
10 μg, 50 μg, 500 μgRecombinant human IL-1B protein (Active, E.coli) [orb3124197]
≥ 95% as determined by SDS-PAGE.
17.4 kDa
500 μg, 50 μg, 10 μgRecombinant Human Interleukin-1 beta protein(IL1B) (Active) [orb1650656]
>97% as determined by SDS-PAGE and HPLC.
17.3 kDa
100 μg, 500 μg, 1 mg, 10 μg, 250 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Human Interleukin-1 beta (IL1B) (Active) (orb2986450)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review