You have no items in your shopping cart.
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 2.045-6.215 ng/mL. |
| Tag | C-terminal 10xHis-tagged |
| Expression Region | 21-132aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 13.7 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Recombinant Human Interleukin-13 (IL13), partial (Active) [orb2657899]
Greater than 95% as determined by SDS-PAGE.
12.3 kDa
Mammalian cell
1 mg, 50 μgRecombinant human IL-13 protein (Active, CHO) [orb2978627]
≥ 95% as determined by SDS-PAGE.
12.3 kDa
10 μg, 50 μg, 500 μgRecombinant Human Interleukin-13 protein(IL13) (Active) [orb1650672]
>97% as determined by SDS-PAGE and HPLC.
12.5 kDa
100 μg, 500 μg, 1 mg, 10 μg, 250 μgRecombinant Human Interleukin-13 protein(IL13) (Active) [orb1650673]
>97% as determined by SDS-PAGE and HPLC.
12.3 kDa
100 μg, 1 mg, 10 μg, 500 μg, 250 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Recombinant Human Interleukin-13 (IL13) (Active) (orb2986835)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review